PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 716aa    MW: 79613.5 Da    PI: 9.8689
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054670.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.61.7e-2153148299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f +l+++++l ++ l+lp + +++ g + ++s +++++de+ rsW + l+++k+s+++++t+GW++F+++ng k+g ++vFkl+g + +++v+++
  Csa07g054670.1  53 FVALVTASNLHNDTLYLPQDLTSSVGRQRNCS-EIVVTDEKERSWPLDLRFNKSSETFYITRGWRSFCDENGKKAGGVFVFKLVG-NWETPVLSF 145
                     568999****************9999998887.***************************************************9.677789999 PP

                     E-S CS
              B3  97 frk 99 
                     +++
  Csa07g054670.1 146 CST 148
                     986 PP

2B361.31.6e-19188282199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++++lk++r +lp +f++++g++k++  ++tl  + g +W   l+ r   g++vl+kGW++FvkangL +g ++++++++ ++++++++
  Csa07g054670.1 188 FVTLTLTHNSLKKCRQYLPSSFLRKNGLDKPG--MITLLGKAGMKWLASLK-REANGSMVLGKGWNDFVKANGLTSGKSFTLEVIS-EKGTPMLS 278
                     67788899*********************766..8***************4.5555569************************998.88999999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f++
  Csa07g054670.1 279 LFST 282
                     9986 PP

3B347.14.1e-15298392199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++ +l ++r +lp +f++++g++k++   +tl  e+g +We +l  r+k g + l+kGWk+F +an +k g+++++k +  ++++++++
  Csa07g054670.1 298 FVTLTLTHTNLIKSRQYLPLSFTKANGLDKPG--LITLVGEDGAKWEANL-LRGKTGIMCLGKGWKHFSRANSIKCGESFTLKAIL-ENGTPMLS 388
                     5566667778888899*************877..7***************.566666799***********************776.88999999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     ++++
  Csa07g054670.1 389 LCST 392
                     9986 PP

4B351.81.5e-16444538199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+l +gr +lp +f++e+g++k++  ++ l  ++g +We ++  r+k g + ++kGWk+F+ angLk+g++++++++  ++++++++
  Csa07g054670.1 444 FVTLTLRHDNLITGRRYLPFSFTRENGLDKPG--KINLIGKDGTKWEANI-GRGKTGVMCIGKGWKNFAIANGLKSGESFTLEVIL-ENGTPMLS 534
                     667778899999*****************777..7***************.455555599***********************887.88889999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f++
  Csa07g054670.1 535 LFST 538
                     9986 PP

5B342.51.1e-136307111398
                     TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     + + ++p +f++++g++k +   +t+  ++  +   +l    k+g + l++GWk+F++ang+k gD+++++ + +++++ v+k+ +
  Csa07g054670.1 630 NILKIIPSQFMKANGINKLG--RITILGQHRMKCFAYL--LSKDGFVALGSGWKGFCEANGVKIGDSFTLECICEQDTTHVFKFSS 711
                     55569**********99877..6999999999998888..999999*************************999888877777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.7E-2145148IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.2E-2148148IPR015300DNA-binding pseudobarrel domain
CDDcd100176.96E-1552136No hitNo description
PROSITE profilePS5086314.74852148IPR003340B3 DNA binding domain
SMARTSM010196.0E-2953149IPR003340B3 DNA binding domain
PfamPF023626.6E-2053148IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-20180287IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-20184281IPR015300DNA-binding pseudobarrel domain
CDDcd100174.79E-15187281No hitNo description
SMARTSM010191.5E-27188283IPR003340B3 DNA binding domain
PROSITE profilePS5086315.425188283IPR003340B3 DNA binding domain
PfamPF023628.2E-19188282IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.9E-16288399IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-17296393IPR015300DNA-binding pseudobarrel domain
CDDcd100171.49E-14297391No hitNo description
SMARTSM010192.7E-24298393IPR003340B3 DNA binding domain
PfamPF023621.6E-14298392IPR003340B3 DNA binding domain
PROSITE profilePS5086313.634298393IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-16441532IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.2E-14441528IPR015300DNA-binding pseudobarrel domain
CDDcd100171.72E-15443537No hitNo description
PROSITE profilePS5086314.353444539IPR003340B3 DNA binding domain
SMARTSM010191.7E-26444539IPR003340B3 DNA binding domain
PfamPF023621.9E-15444538IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.0E-14580602IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508638.727618712IPR003340B3 DNA binding domain
SMARTSM010192.3E-10622713IPR003340B3 DNA binding domain
PfamPF023623.2E-12630711IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-13632711IPR015300DNA-binding pseudobarrel domain
CDDcd100172.63E-9634710No hitNo description
Gene3DG3DSA:2.40.330.103.0E-14634712IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 716 aa     Download sequence    Send to blast
MFSAGNILRK KHRRMRTDEG DDDQDNTEHV RNKKWKNSFE TEVDSSSSDH SCFVALVTAS  60
NLHNDTLYLP QDLTSSVGRQ RNCSEIVVTD EKERSWPLDL RFNKSSETFY ITRGWRSFCD  120
ENGKKAGGVF VFKLVGNWET PVLSFCSTES INDGTQGDKN NKENCMQLER KQKRMRCRVS  180
TLPSQNRFVT LTLTHNSLKK CRQYLPSSFL RKNGLDKPGM ITLLGKAGMK WLASLKREAN  240
GSMVLGKGWN DFVKANGLTS GKSFTLEVIS EKGTPMLSLF STQSTSERSQ QRASMNRFVT  300
LTLTHTNLIK SRQYLPLSFT KANGLDKPGL ITLVGEDGAK WEANLLRGKT GIMCLGKGWK  360
HFSRANSIKC GESFTLKAIL ENGTPMLSLC STQSTSDRSQ QGECSKGSEK ESILAGHSSG  420
KETRKAKDKI EGRRDSLPAS MNRFVTLTLR HDNLITGRRY LPFSFTRENG LDKPGKINLI  480
GKDGTKWEAN IGRGKTGVMC IGKGWKNFAI ANGLKSGESF TLEVILENGT PMLSLFSTEA  540
TSGRSQQGER CKDSEKGSIS AEPTRGNKAT SNREERTDSS SAIRNRFVTL TLTPEDVRDC  600
KLVSSSDKSC FEDVLVYVLI PISNELYYSN ILKIIPSQFM KANGINKLGR ITILGQHRMK  660
CFAYLLSKDG FVALGSGWKG FCEANGVKIG DSFTLECICE QDTTHVFKFS SNSVE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417224.10.0PREDICTED: B3 domain-containing protein REM12-like
SwissprotP0CAP41e-155REM12_ARATH; B3 domain-containing protein REM12
TrEMBLD7LIB40.0D7LIB4_ARALL; Predicted protein
STRINGAl_scaffold_0004_4880.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.11e-149B3 family protein